DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG33721

DIOPT Version :10

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:173 Identity:66/173 - (38%)
Similarity:101/173 - (58%) Gaps:4/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLVTIFL--IRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQIKV 69
            |::.||.  |.:..|.:|.|||:|...|..:..||||.:|||||||||||||.::::.|:.....
  Fly     9 FVLVIFFGNIMENASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPITNASA 73

  Fly    70 NTAIYKRLNGYKPFLYNVTVDGCKFI--KNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIMEKL 132
            ...|.:|...|.|.....::|.||::  |...:||:.:....:.|..||.||.||||||:|:::|
  Fly    74 KLQISRRFRSYMPITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHDLIIDRL 138

  Fly   133 SAESINFQITKILPFPEGKYMVKMNWFAYDINRAIIRLYITLT 175
            .::.::...|.|||.|.|.|.....|::.:|.||.|.:|.|::
  Fly   139 PSKYLSEHFTNILPLPPGDYSFNSIWYSRNIERATISIYYTVS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:461928 30/86 (35%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 30/85 (35%)

Return to query results.
Submit another query.