DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG33725

DIOPT Version :9

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:185 Identity:59/185 - (31%)
Similarity:93/185 - (50%) Gaps:40/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTIFLIRKVHSLV---------EITNFECESLDRNFSDFEYCRLKSVNRTYKYISLK---VHLF 60
            |||..|...|..||         :.|||.|.|.::::..|..||||:|:|....::..   :|  
  Fly     5 LVTSILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH-- 67

  Fly    61 QTPVNQIKVNTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPY-- 123
              |.|.|.|:..::|:.||:||:|.:|.:|.|:|::. |.:|..:.||.:|||.:.:||:|||  
  Fly    68 --PANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRT-NFHPFVRIIFDLFKDFSTINHTCPYVG 129

  Fly   124 -----DHDIIMEKLSAESINFQITKILPFPEGKYMVKMNWF-----AYDINRAII 168
                 |..:..|||.           ||||.|.|::.:.|.     .:|.|.:.:
  Fly   130 LQVVKDFYLRPEKLK-----------LPFPSGDYLLSLIWIFDKRPQFDTNVSFV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 33/91 (36%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 33/91 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.