DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG33630

DIOPT Version :9

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:151 Identity:29/151 - (19%)
Similarity:59/151 - (39%) Gaps:32/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIFSVGFLVTIFLIRKVHSLVEITNFECESLDRNFSDFEYCRLK-SVNRTYKYISLKVHL-FQTP 63
            |.:|......:..|:::|.               |.:..|.:.| .::....:..|.|.| .:..
  Fly    27 MEYSTSPKKAVVAIKQIHV---------------FGESNYMKAKIYIHEDRSHFDLHVQLVHELG 76

  Fly    64 VNQIKVNTAIYKRLNGYKPF--LYNV-TVDGCKFIKNQNSNPVTKFIFGVFKDATNMNH--SCP- 122
            .|.:.:|..:..:..|...|  |:.: .::.|:|:...|:||:.:.   :||....:|.  .|| 
  Fly    77 SNHLIMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNPMMEM---MFKKNVKLNDIIVCPV 138

  Fly   123 ----YD--HDIIMEKLSAESI 137
                |.  :..|.|.:.|:.:
  Fly   139 RVGNYSLLNSDIAENIHADGV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 18/81 (22%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.