DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG33928

DIOPT Version :9

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:171 Identity:83/171 - (48%)
Similarity:113/171 - (66%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTIFLIRKVH----SLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQIKV 69
            |..|:..::|    |.:|.||.:|.|:|:.|||||||.||:.||||||:|:||.|::.||:...|
  Fly    11 VIYFMFFQMHLVESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTV 75

  Fly    70 NTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIMEKLSA 134
            |..::||.||..||..|.|.||||.:.|. .||:..|:|.:||..:|:||||||.||||::||..
  Fly    76 NLGLHKRSNGLMPFNQNFTFDGCKMVANV-GNPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPT 139

  Fly   135 ESINFQITKILPFPEGKYMVKMNWFAYDINRAIIRLYITLT 175
            ..:|.|.||.:|.|||.|:...|||....||||:|::.:.|
  Fly   140 HFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSFT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 43/84 (51%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 43/84 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472027
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.