DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG33775

DIOPT Version :9

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:175 Identity:56/175 - (32%)
Similarity:97/175 - (55%) Gaps:3/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIFSVGFLVTIFLIRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVN 65
            ::.:...|.::.|..:..|.....|.:|||.:.:::.||.|:|..:.|......:.:.||||||.
  Fly    10 ILVTAAILCSLSLGSECRSKSRFINMQCESYNESYAVFEKCKLNLLGRGRVGADMYLKLFQTPVE 74

  Fly    66 QIKVNTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIME 130
            ...:|.|:|:|.||::||||||:.|.|:.:.|.|:......:....|..:|:||||||:||||::
  Fly    75 NCWINWAMYRRYNGFQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVD 139

  Fly   131 KLSAESINFQITKILPFPEGKYMVKMNWFAYDINRAIIRLYITLT 175
            .:   ..:....|.||.|:|.|.:::.:..|.:.|..:.::|..|
  Fly   140 NM---EFSDDFLKTLPLPQGVYKIQLRFATYKVWRVQVAVFIERT 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 34/84 (40%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 34/84 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472226
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.