DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG33643

DIOPT Version :9

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:142 Identity:32/142 - (22%)
Similarity:55/142 - (38%) Gaps:31/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRL-KSVNRTYKYISLKVH-LFQTPVNQIKV-NTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNP 102
            |:: :|.||:|    :..| |....|.:... |...:.|.||.:..||...:|.|..:.:...|.
  Fly    45 CQVDQSSNRSY----VNCHMLLNREVGKFDARNVLDFVRPNGQEMKLYEGRLDACLLLGSIQKNR 105

  Fly   103 VTKFIFGVFKDATNMNHSCPY--DHDIIMEKLSAESINFQITKILP--FPEGKYMVKMNWFAYDI 163
            :.......||..:|:  .||.  :.:..|:.|..:..:|      |  .|.|.:           
  Fly   106 LVNIYSKTFKRFSNV--ECPLKANFNYTMKNLYMDEQDF------PSFVPSGTF----------- 151

  Fly   164 NRAIIRLYITLT 175
             |::|..|:..|
  Fly   152 -RSLIEFYLNQT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 20/89 (22%)
CG33643NP_001027258.1 DUF1091 75..152 CDD:284008 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.