DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG33783

DIOPT Version :9

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster


Alignment Length:152 Identity:49/152 - (32%)
Similarity:83/152 - (54%) Gaps:3/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQIKVNTAIYKRLNGYKPFLY 85
            :.:.|.:|...:::|.:.:.|.||.:.|....:.|.....|.|:|......::|:|.|||:||||
  Fly     8 IGVVNIKCTCYEKSFCELKRCELKVLGRGIVGLFLHAQAHQLPINSSTCILSLYRRFNGYRPFLY 72

  Fly    86 NVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIMEKLSAESINFQITKILPFPEG 150
            |:|||.|.|.||:...|....::...|:.:|:|||||::||||:.::   .:|..:...:|||.|
  Fly    73 NMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRM---VLNDNMIVKVPFPSG 134

  Fly   151 KYMVKMNWFAYDINRAIIRLYI 172
            .|.:........|.|..:.:|:
  Fly   135 FYKLMFILKTDGIWRGEVEVYV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 35/84 (42%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 35/80 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472223
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.