DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG33454

DIOPT Version :9

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:155 Identity:60/155 - (38%)
Similarity:97/155 - (62%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLVTIFLIRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHL---FQTPVNQIK 68
            |:..:||:....::|::||..|||.|::.:.|.|||||:.:||    ...:|:   |..|:|.|.
  Fly    11 FVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRT----KTSLHINATFLHPINSIS 71

  Fly    69 VNTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIMEKLS 133
            |...:.||.|||||||:::|||.|:|::..| |||.|.::.:.|||:|:||||||...::.:   
  Fly    72 VRFQMLKRANGYKPFLFDITVDACQFLRKPN-NPVIKIVYNMIKDASNINHSCPYGTVVLND--- 132

  Fly   134 AESINFQITKILPFPEGKYMVKMNW 158
                ..:|:..||||.|.|:.::::
  Fly   133 ----FHRISLPLPFPSGDYLSRLDF 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 37/84 (44%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 36/83 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472540
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.