DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG33467

DIOPT Version :9

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:182 Identity:45/182 - (24%)
Similarity:81/182 - (44%) Gaps:24/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VGFLVTIFLIRKVHSLVEITNFECESLD---RNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVN- 65
            :|.:....|:.|      .|..||:...   :|.|    |.:|.:|.....::|..:|....:| 
  Fly    14 IGHMTDSQLVYK------FTKVECQGNQARVKNVS----CNVKPINWNTALVNLDCYLIYPLINP 68

  Fly    66 QIKVNTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIME 130
            .|:|...:....|.|||||.:.|...|..::.:|..|....::.:|:..||:. ||   |  |..
  Fly    69 TIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SC---H--ISG 127

  Fly   131 KLSAESINFQITKILPFPEGKYMVKMNWF-AYDINR---AIIRLYITLTNSI 178
            :|||.:.....:.:.|||.|:|.:.:.:. :...||   .|::.::...:.|
  Fly   128 QLSARNGYLNSSYVPPFPHGQYQISVMFSDSNSTNREFVGIVKFFVQAMDEI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 26/84 (31%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472536
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.