DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9130 and CG9133

DIOPT Version :9

Sequence 1:NP_001027095.1 Gene:CG9130 / 3772105 FlyBaseID:FBgn0035197 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001027093.1 Gene:CG9133 / 3772453 FlyBaseID:FBgn0035198 Length:332 Species:Drosophila melanogaster


Alignment Length:310 Identity:62/310 - (20%)
Similarity:86/310 - (27%) Gaps:123/310 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 EPCCGPCGPCGPCGPCPPPPSCGSCPPPPSCGPPCPPPCDPC----------------------- 279
            :.|.|.|.....|...|....|...|..|..||......:.|                       
  Fly    36 DDCDGCCQCACDCDCSPELAPCFIQPTKPDPGPEAYDEFEACLNGSGLTIRVLKNTHKVESVMDG 100

  Fly   280 -----------DPC---DP--CSPCCGGGTATGGPMDKKGC------KGSCAQPPCRRCT----M 318
                       |||   ||  |.|.            |:.|      :.|.|:...:|.|    :
  Fly   101 SETAPNLGAGDDPCYRDDPNDCEPA------------KESCLHDMLQRSSFARNHIKRRTGGRII 153

  Fly   319 VDPCAKRVEPPAKCLRYYSCNLDKLC--------PCDYCEDEFD----REC----PTVPT----- 362
            ..|...:|....|.....:|..|...        .||:.|.:.|    |.|    |.||.     
  Fly   154 NHPNIPKVRANIKYSGNDACETDNYYVPFSKIKEACDFQEAKVDCYRQRLCGGSDPIVPAHCPVQ 218

  Fly   363 ------------------KRCNLSPIEQKLQKC-GPCG-----------GIPPYPRFIQEKMQAE 397
                              |..||....:.::.| ..|.           |.....:..:..::.|
  Fly   219 NQRSCCMQVERKDIMDTMKGVNLDTRRKGIEVCYKTCEETDSDVFLVKLGSKAKSQHKKNTIEIE 283

  Fly   398 L----------LNKPEKDPKKDKDGKKGGKDGKDAKDGKGGKDDKGKKKR 437
            |          ::|...:....::...|||.||..|.|| ||..|||||:
  Fly   284 LRTPKQPVTLPISKVTTETYVSEEMLTGGKKGKKGKKGK-GKKGKGKKKK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9130NP_001027095.1 DUF4497 84..221 CDD:291585
CG9133NP_001027093.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C8Z4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.