DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and AT1G74680

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_565089.1 Gene:AT1G74680 / 843807 AraportID:AT1G74680 Length:461 Species:Arabidopsis thaliana


Alignment Length:369 Identity:80/369 - (21%)
Similarity:136/369 - (36%) Gaps:108/369 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 KCEHDR--LKVYIYPL-QEF------------------------------VDEQSD----KTATT 129
            ||:.||  |||::|.| .||                              ::.|..    .|...
plant    67 KCDRDRDVLKVFMYDLPSEFHFGILNWHKKGSEIWPNVNNISTIPSYPGGLNRQHSVEYWLTLDL 131

  Fly   130 LSSEYFQILEAVLKSRYYTSNPNEA-CLFLPSLDLLNQNVFDKHLAG---------------AAL 178
            |:||..:|......:.....|.||| .:|:|....|:.|...| |.|               ..|
plant   132 LASETPEIKRPCSSAAIRVKNSNEADIVFVPFFASLSYNRKSK-LRGNETSSDDRLLQERLVEFL 195

  Fly   179 ASLDFWDR--GANHIIFNMLPGGAPSYNTVLDVNTDNAIIFGGGF---------DSWSYRPGF-- 230
            .|.|.|.|  |.:|:|....|               |::::...|         |...|....  
plant   196 KSQDEWKRFDGKDHLIVAHHP---------------NSLLYARNFLGSAMFVLSDFGRYSSAIAN 245

  Fly   231 ---DVAIP-VWSPRLVRQHAHATAQRKFLLVVAQLNILPRFVRTLRE--LSLAHSEQLLLLGACE 289
               |:..| |...:.:..:..|:.:::.:|...|..|..:...|:|:  .:|...|:        
plant   246 LEKDIIAPYVHVVKTISNNESASFEKRPVLAYFQGAIYRKDGGTIRQELYNLLKDEK-------- 302

  Fly   290 NLDLTMRCPLSQHHKSLEYPRLLSRGKFCLLGRSLRMGQPD---LVEIMSQHCIPVIAVDNYVLP 351
              |:.......:.:.:.:..:.::..||||   ::....|.   |.:.:..||:|||..|...||
plant   303 --DVHFAFGTVRGNGTKQTGKGMASSKFCL---NIAGDTPSSNRLFDAIVSHCVPVIISDQIELP 362

  Fly   352 FEDVIDWSLASVRIRENELHSVMQKLKAISSVK-IVEMQKQVQW 394
            |||.:|:|..||.:..:|   .::|...::.:: |.|.|.:.:|
plant   363 FEDTLDYSGFSVFVHASE---AVKKEFLVNILRGITEDQWKKKW 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 74/349 (21%)
Glyco_transf_64 455..689 CDD:286358
AT1G74680NP_565089.1 Exostosin 75..391 CDD:397245 72/347 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.