DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and GUT1

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_568941.1 Gene:GUT1 / 836306 AraportID:AT5G61840 Length:415 Species:Arabidopsis thaliana


Alignment Length:346 Identity:75/346 - (21%)
Similarity:118/346 - (34%) Gaps:102/346 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RLKVYIYPLQEFVDE---QSDKTATT--LSSE-YFQILEAVLKSRYYTSNPNEACLF-------- 157
            ||||::|.|....::   |.|.....  .::| |.|  ..:|.|...|.||.||..|        
plant    48 RLKVFVYELPSKYNKKILQKDPRCLNHMFAAEIYMQ--RFLLSSPVRTLNPEEADWFYVPVYTTC 110

  Fly   158 --------LP---------SLDLLNQNVFDKHLAGAALASLDFWDR--GANHIIFNMLPGGAPSY 203
                    ||         ::.|:..|             ..:|:|  ||:|  |.::|   ..:
plant   111 DLTPNGLPLPFKSPRMMRSAIQLIASN-------------WPYWNRTEGADH--FFVVP---HDF 157

  Fly   204 NTVLDVNTDNAIIFG--------------GGFDSWSYRPGFDVAIPVWSPRLVRQHAHATAQRKF 254
            ........:.||..|              |..:....:.| .:.:|.::|          .|:  
plant   158 GACFHYQEEKAIGRGILPLLQRATLVQTFGQRNHVCLKEG-SITVPPYAP----------PQK-- 209

  Fly   255 LLVVAQLNILPRFVRTLRELSLAHSEQLLLLG---------------ACENLDLTMRCPLSQHHK 304
                .|.:::|.  :|.|.:.:........:|               ..||........:|..|.
plant   210 ----MQSHLIPE--KTPRSIFVYFRGLFYDVGNDPEGGYYARGARAAVWENFKDNPLFDISTEHP 268

  Fly   305 SLEYPRLLSRGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENE 369
            :..|.. :.|..|||.........|.|||.:...|||||..|:.||||.|.|.|....|.:.|.:
plant   269 TTYYED-MQRAIFCLCPLGWAPWSPRLVEAVIFGCIPVIIADDIVLPFADAIPWEDIGVFVDEKD 332

  Fly   370 LHSVMQKLKAISSVKIVEMQK 390
            :..:...|.:|....|:..|:
plant   333 VPYLDTILTSIPPEVILRKQR 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 72/334 (22%)
Glyco_transf_64 455..689 CDD:286358
GUT1NP_568941.1 Exostosin 48..343 CDD:397245 72/334 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.