DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and AT5G25820

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_197954.1 Gene:AT5G25820 / 832651 AraportID:AT5G25820 Length:654 Species:Arabidopsis thaliana


Alignment Length:344 Identity:79/344 - (22%)
Similarity:143/344 - (41%) Gaps:79/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YKCEHDRLKVYIY-----PLQEFVDEQSDKTATTLSSE--YFQILEAVLKSRYYTSNPNEACLF- 157
            |:.....||||.|     |:.     .|.......:||  :..|:|: ..:::.|.:|.:|.|| 
plant   317 YELMEKILKVYAYKEGNKPIM-----HSPILRGIYASEGWFMNIIES-NNNKFVTKDPAKAHLFY 375

  Fly   158 LP-SLDLLNQNVF--DKHLAGAAL-----------ASLDFWDR--GANHII---FNMLPGG---- 199
            || |..:|...::  |.|.....:           |...||:|  ||:|.:   .:..|..    
plant   376 LPFSSRMLEVTLYVQDSHSHRNLIKYLKDYIDFISAKYPFWNRTSGADHFLAACHDWAPSETRKH 440

  Fly   200 -APSYNTVLDVNTDNAIIFGGGFDSWSYRPGFDVAIP---VWSPR--LVRQHAHATAQRKFLLVV 258
             |.|...:.:.:.....:||.           |.::|   |..|:  |......:..||.     
plant   441 MAKSIRALCNSDVKEGFVFGK-----------DTSLPETFVRDPKKPLSNMGGKSANQRP----- 489

  Fly   259 AQLNILPRFVRT-----LRELSLAHSEQLLLLGACENLDLTM--RCPLSQHHKSLEYPRLLSRGK 316
                ||..|...     ||.:.|::      .|..::.||.:  :.|.::.:|:  |.:.:...|
plant   490 ----ILAFFAGKPDHGYLRPILLSY------WGNNKDPDLKIFGKLPRTKGNKN--YLQFMKTSK 542

  Fly   317 FCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQKLKAIS 381
            :|:..:...:..|.:||.:...|:|||..||:|.||.:|::|...::.|.|.::.::.:.|.:|.
plant   543 YCICAKGFEVNSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWESFAIFIPEKDIPNLKKILMSIP 607

  Fly   382 SVKIVEMQKQVQWLFSKYF 400
            ..:...||.:|:.: .|:|
plant   608 ESRYRSMQMRVKKV-QKHF 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 72/318 (23%)
Glyco_transf_64 455..689 CDD:286358
AT5G25820NP_197954.1 Exostosin 320..606 CDD:281069 72/319 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.