DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and AT5G25310

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_197913.4 Gene:AT5G25310 / 832603 AraportID:AT5G25310 Length:480 Species:Arabidopsis thaliana


Alignment Length:424 Identity:91/424 - (21%)
Similarity:158/424 - (37%) Gaps:115/424 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RDGFFHGKRDSHTLILDLEHIQE-----------LAVNPE------------AEQRA------RN 89
            |:.:.....:.:.:::|..|:.:           |...||            |:.||      .|
plant    54 RNVYTSSSGEENRVVVDSRHVSQQILTVRSTNSTLQSKPEKLNRRNLVEQGLAKARASILEASSN 118

  Fly    90 VNCTFW--DCLN--IYKCE----------HDRLKVYIYPLQE--FVDEQSDKTATTLSSEYFQIL 138
            ||.|.:  |..|  ||:..          ..|.|||:|...|  .|.:...|:...:...:...:
plant   119 VNTTLFKSDLPNSEIYRNPSALYRSYLEMEKRFKVYVYEEGEPPLVHDGPCKSVYAVEGRFITEM 183

  Fly   139 EAVLKSRYYTSNPNEACL-FLP-SLDLLNQNVFDKHLAGAALASL------------DFWDR--G 187
            |. .::::.|.:||:|.: ||| |:..|.:.:::.:.....|.:.            .||:|  |
plant   184 EK-RRTKFRTYDPNQAYVYFLPFSVTWLVRYLYEGNSDAKPLKTFVSDYIRLVSTNHPFWNRTNG 247

  Fly   188 ANHIIFNMLPGGAPSYNTVLDVNTDNAIIFGGGFDSWSYRPGFDVAIPVWSPRLVRQHAHATAQR 252
            |:|.:......|..:.....|:...:..:......|..:.|..||.:|                 
plant   248 ADHFMLTCHDWGPLTSQANRDLFNTSIRVMCNANSSEGFNPTKDVTLP----------------- 295

  Fly   253 KFLLVVAQLNILPRFVRTL-------------------RELSLAHSEQLLLLGACENLDLTMRCP 298
            :..|...:::...|..:||                   |.:.|.|.:|       .:||:.:...
plant   296 EIKLYGGEVDHKLRLSKTLSASPRPYLGFFAGGVHGPVRPILLKHWKQ-------RDLDMPVYEY 353

  Fly   299 LSQHHKSLEYPRLLSRGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASV 363
            |.:|   |.|...:...|||.......:..|.::|.:...|||||...|:||||.||:.|...||
plant   354 LPKH---LNYYDFMRSSKFCFCPSGYEVASPRVIEAIYSECIPVILSVNFVLPFTDVLRWETFSV 415

  Fly   364 RIRENELHSVMQKLKAISSVKIVEMQKQVQWLFS 397
            .:..:|:..:.:.|.:||:.|       .:||.|
plant   416 LVDVSEIPRLKEILMSISNEK-------YEWLKS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 68/311 (22%)
Glyco_transf_64 455..689 CDD:286358
AT5G25310NP_197913.4 Exostosin 147..432 CDD:281069 68/312 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.