DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and AT5G20260

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_197526.6 Gene:AT5G20260 / 832148 AraportID:AT5G20260 Length:466 Species:Arabidopsis thaliana


Alignment Length:341 Identity:74/341 - (21%)
Similarity:128/341 - (37%) Gaps:101/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RLKVYIY-----PLQEFVDEQSDKTATTLSSEYFQILEAVLKSRYYTSNPNEACLFLPSLDLLN- 165
            :.||::|     ||   |.........::..::...:|..: |.:..:||.||..||..:.:.| 
plant   136 KFKVWVYREGETPL---VHMGPMNNIYSIEGQFMDEIETGM-SPFAANNPEEAHAFLLPVSVANI 196

  Fly   166 ----------------QNVFDKHLAGAALASLDFWDR--GANHIIFNM------LPGGAPS---- 202
                            ..||..::...| ....:|:|  ||:|...:.      :.|..|.    
plant   197 VHYLYRPLVTYSREQLHKVFLDYVDVVA-HKYPYWNRSLGADHFYVSCHDWAPDVSGSNPELMKN 260

  Fly   203 -YNTVLDVNTDNAIIFGGGFDSWSYRPGFDVAIP--------VWSPRLVRQHAHATAQRKFLLVV 258
             ...:.:.||           |..:.|..||:||        :..|||.|...|           
plant   261 LIRVLCNANT-----------SEGFMPQRDVSIPEINIPGGHLGPPRLSRSSGH----------- 303

  Fly   259 AQLNILPRFV----RTLRELSLAH----SEQLLLLGACENLDLTMRCPLSQHH----KSLEYPRL 311
             ...||..|.    ..:|.:.|.|    .|::                  |.|    |:.:|.:|
plant   304 -DRPILAFFAGGSHGYIRRILLQHWKDKDEEV------------------QVHEYLAKNKDYFKL 349

  Fly   312 LSRGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQK 376
            ::..:|||......:..|.:|..::..|:|||..|:|.|||.||:||:..::.:...::..:...
plant   350 MATARFCLCPSGYEVASPRVVAAINLGCVPVIISDHYALPFSDVLDWTKFTIHVPSKKIPEIKTI 414

  Fly   377 LKAISSVKIVEMQKQV 392
            ||:||..:...:|::|
plant   415 LKSISWRRYRVLQRRV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 70/327 (21%)
Glyco_transf_64 455..689 CDD:286358
AT5G20260NP_197526.6 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.