DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and AT5G16890

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_197191.1 Gene:AT5G16890 / 831552 AraportID:AT5G16890 Length:511 Species:Arabidopsis thaliana


Alignment Length:472 Identity:89/472 - (18%)
Similarity:165/472 - (34%) Gaps:114/472 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QSRAISHTNPREHILNCLTYGLLVIVALCAGFLLWDLSSSPRDGFFH---GKRDSHTLILDLEH- 73
            |:...:.:.||...|  :..|.|..|:|..  :|:..|||.|....:   ..|...:.:..||| 
plant     6 QNHRSTSSRPRSKTL--ILIGSLFTVSLLV--ILYTSSSSSRASISNPNPSDRPETSFVTSLEHF 66

  Fly    74 -----------IQELAVNPEAEQRARNVNCTFWDCLNIYKCEHD------RLKVYIYPL-QEFVD 120
                       :::..|..|::...|.::...::..|.:..|..      .:|||:|.: ::|..
plant    67 LIYKAPKLSLPVRDDTVRGESDDDVRKLDEMVFERENRWLNEDPGYPVEFPIKVYVYEMPKKFTF 131

  Fly   121 E---------QSDKTATTLSSEYFQIL------------------EAVLKSRYYTSNPNEACLF- 157
            :         :....||:..|...:::                  |..|||........:|..| 
plant   132 DLLWLFHNTYKETSNATSNGSPVHRLIEQHSIDYWLWADLISPESERRLKSVVRVQKQQDADFFY 196

  Fly   158 LPSLDLLNQNVFDKHLAGAA-------LASLDFWDR--GANHIIFNMLPGGAP-SYNTVLDVNTD 212
            :|....::..:.:|....|.       :.....|.|  |.:||    .|...| |:.:|... ..
plant   197 VPFFTTISFFLLEKQQCKALYREALKWVTDQPAWKRSEGRDHI----FPIHHPWSFKSVRKF-VK 256

  Fly   213 NAIIFGGGFDS---WSYRPGFDVAIPVWSPRLVRQHAHATAQRKFLL-VVAQLNILPRFVRTLRE 273
            |||......||   | |:||                 ..:.::..:| .|..::|..  .:.|.|
plant   257 NAIWLLPDMDSTGNW-YKPG-----------------QVSLEKDLILPYVPNVDICD--TKCLSE 301

  Fly   274 LSLAHSEQLLLLGACE-NLDLTMRCPLSQHHK----------------SLEYPRLLSRGKFCLLG 321
            .:...:..|...|..: |....:|..|.....                .|...|.:.|..|||..
plant   302 SAPMRTTLLFFRGRLKRNAGGKIRAKLGAELSGIKDIIISEGTAGEGGKLAAQRGMRRSLFCLCP 366

  Fly   322 RSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHS---VMQKLKAISSV 383
            .........|.:.:...|||||..|....|||.::|:...:|.:..::...   ::..|::::..
plant   367 AGDTPSSARLFDAIVSGCIPVIVSDELEFPFEGILDYKKVAVLVSSSDAIQPGWLVNHLRSLTPF 431

  Fly   384 KIVEMQKQVQWLFSKYF 400
            ::..:|..:. .:|::|
plant   432 QVKGLQNNLA-QYSRHF 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 64/343 (19%)
Glyco_transf_64 455..689 CDD:286358
AT5G16890NP_197191.1 Exostosin 117..423 CDD:397245 63/330 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.