DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and AT4G38040

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_195517.1 Gene:AT4G38040 / 829960 AraportID:AT4G38040 Length:425 Species:Arabidopsis thaliana


Alignment Length:373 Identity:98/373 - (26%)
Similarity:154/373 - (41%) Gaps:82/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KRDSHTLILDLEHIQELAVNPEAEQRARNVNCTFWDCLNIYKCEHDRLKVYIYP---LQEFVDEQ 122
            |.|:.|..::.|...::..:|||.:            ||..:.| .|.||||||   ...|....
plant    70 KTDNETPTMEEETYSDVYHSPEAFR------------LNYAEME-KRFKVYIYPDGDPNTFYQTP 121

  Fly   123 SDKTATTLSSEYFQILEAVLKSRYYTSNPNEACL-FLP--------------SLDLLNQNVFDKH 172
            ...|....|..||  .:.:.:||:.|.:|:||.| |:|              ::.::.||..|  
plant   122 RKVTGKYASEGYF--FQNIRESRFRTLDPDEADLFFIPISCHKMRGKGTSYENMTVIVQNYVD-- 182

  Fly   173 LAGAALASLDFWDR--GANHIIFNMLPGGAPSY--NTVLDVNTDNAIIFGGGFDSWSYRPGF--- 230
               ..:|...:|:|  ||:|........|..::  :.:|..||...:.      |.||..||   
plant   183 ---GLIAKYPYWNRTLGADHFFVTCHDVGVRAFEGSPLLIKNTIRVVC------SPSYNVGFIPH 238

  Fly   231 -DVAIP-VWSPRLVRQHAHATAQRKFL-LVVAQLNILPRFVRTLRELSLAHSEQLLLLGACEN-- 290
             |||:| |..|..:....:....|..| ......|...|.:       |||        ..||  
plant   239 KDVALPQVLQPFALPAGGNDVENRTTLGFWAGHRNSKIRVI-------LAH--------VWENDT 288

  Fly   291 -LDLT-MRCPLSQHHKSLEYPRLLSRGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFE 353
             ||:: .|...:..|  |.|.:...|.|||:.....::....:.:.:...|||||..|.|.|||.
plant   289 ELDISNNRINRATGH--LVYQKRFYRTKFCICPGGSQVNSARITDSIHYGCIPVILSDYYDLPFN 351

  Fly   354 DVIDWSLASVRIRENELHSVMQKLKAISSVK-------IVEMQKQVQW 394
            |:::|...:|.:||.:::::.|.||.|...:       :|::||..||
plant   352 DILNWRKFAVVLREQDVYNLKQILKNIPHSEFVSLHNNLVKVQKHFQW 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 82/306 (27%)
Glyco_transf_64 455..689 CDD:286358
AT4G38040NP_195517.1 Exostosin 100..378 CDD:397245 83/308 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.