DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and AT4G16745

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001190743.1 Gene:AT4G16745 / 827378 AraportID:AT4G16745 Length:589 Species:Arabidopsis thaliana


Alignment Length:448 Identity:105/448 - (23%)
Similarity:188/448 - (41%) Gaps:85/448 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LLWDLSSSPRDGFFHGKRDSHTLILDLEHIQELAVNPEAEQRARNV-NCT-----FWDCLNIYKC 103
            :|.|...:||    |....|....|.|...:.|.......|||..| |.|     .:..|:::|.
plant   131 ILTDPPPAPR----HVLSSSERRALSLPPKKALTYAKLEIQRAPEVINDTDLFAPLFRNLSVFKR 191

  Fly   104 EHDR----LKVYIYPLQEFVDEQSDKTA-------TTLSSE--YFQILEAVLKSRYYTSNPNEAC 155
            .::.    |||||||       ..||..       ...:||  :.:::|:  ..::.|.||..|.
plant   192 SYELMELILKVYIYP-------DGDKPIFHEPHLNGIYASEGWFMKLMES--NKQFVTKNPERAH 247

  Fly   156 LF-LP-SLDLLNQNVF---DKHLAGAALASLD----------FWDR--GANHIIFNMLPGGAPSY 203
            || :| |:..|.:::|   ..::...::...|          ||:|  |::|.:......|..:.
plant   248 LFYMPYSVKQLQKSIFVPGSHNIKPLSIFLRDYVNMLSIKYPFWNRTHGSDHFLVACHDWGPYTV 312

  Fly   204 NTVLDVNTDNAI--IFGGGFDSWSYRPGFDVAIPVWSPRLVRQ------HAHATAQRKFLLVVA- 259
            |...::.. |||  :.........:.||.||::|..|.|...:      :.:..:||..|...| 
plant   313 NEHPELKR-NAIKALCNADLSDGIFVPGKDVSLPETSIRNAGRPLRNIGNGNRVSQRPILAFFAG 376

  Fly   260 --QLNILPRFVRTLRELSLAHSEQLLLLGACENLDLTMRCPLSQHHKSLEYPRLLSRGKFCLLGR 322
              ...:.|:.::..|.    ..|.:.:.|...: ::..:....||.||         .|:||...
plant   377 NLHGRVRPKLLKHWRN----KDEDMKIYGPLPH-NVARKMTYVQHMKS---------SKYCLCPM 427

  Fly   323 SLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQKLKAISSVKIVE 387
            ...:..|.:||.:...|:||:..||::|||.||:|||..||.:.|.|:..:.:.|..|...:.::
plant   428 GYEVNSPRIVEAIYYECVPVVIADNFMLPFSDVLDWSAFSVVVPEKEIPRLKEILLEIPMRRYLK 492

  Fly   388 MQKQVQ-----WLFSKYFKDLKTVTLTALEVLESRIFPL-----RARSSRQWNTIDTN 435
            ||..|:     :|:|...:.:|......:.:|:..:.|.     :.|::|.:.:|.::
plant   493 MQSNVKMVQRHFLWSPKPRKIKPFVKERITILKLLLQPAVYHVWKKRNARIFTSIPSS 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 76/315 (24%)
Glyco_transf_64 455..689 CDD:286358
AT4G16745NP_001190743.1 Exostosin 200..482 CDD:281069 75/305 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.