DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and FRA8

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_850113.2 Gene:FRA8 / 817357 AraportID:AT2G28110 Length:448 Species:Arabidopsis thaliana


Alignment Length:390 Identity:85/390 - (21%)
Similarity:147/390 - (37%) Gaps:85/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NIYKCEHDRLKVYIYPLQEFVDEQ---SDKTATTLSSEYFQILEAV--LKSRYYTSNPNEA-CLF 157
            ||.....:.||:|:|.|....::.   :|:....|.:....:.:|.  |:....|.:|.|| ..|
plant    85 NIKTDVFNNLKIYVYDLPSKFNKDWLANDRCTNHLFAAEVALHKAFLSLEGDVRTEDPYEADFFF 149

  Fly   158 LP---SLDLLNQNVFD-----KHLAGAAL----ASLDFWDR--GANHIIFNMLPGGAPSYNTVLD 208
            :|   |.:....|.|.     :.|...|:    ....||:|  |::| :|.........::|:.|
plant   150 VPVYVSCNFSTINGFPAIGHARSLINDAIKLVSTQYPFWNRTSGSDH-VFTATHDFGSCFHTMED 213

  Fly   209 --------VNTDNAII---FGGGFDSWSYRPGFDVAIPVWSPRLVRQHAHATAQRKFLLVVAQ-- 260
                    :...|:||   ||..|:    .|..:|...|..|.:..:..|.|  :|.:.|..:  
plant   214 RAIADGVPIFLRNSIILQTFGVTFN----HPCQEVENVVIPPYISPESLHKT--QKNIPVTKERD 272

  Fly   261 -------------LNILPRF----VRTLRELSLAHSEQLLLLGACENLDLTMRCPLSQHHKSLEY 308
                         .||..||    |||....|.....:..|                |..:...|
plant   273 IWVFFRGKMELHPKNISGRFYSKRVRTNIWRSYGGDRRFYL----------------QRQRFAGY 321

  Fly   309 PRLLSRGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSV 373
            ...::|..|||.........|.|||.::..|:|||..|...|||...:.|...|:.:.|.::..:
plant   322 QSEIARSVFCLCPLGWAPWSPRLVESVALGCVPVIIADGIRLPFPSTVRWPDISLTVAERDVGKL 386

  Fly   374 MQKLKAISSVKIVEMQKQVQ-------WLFSKYFKDLKTVTLTALEVLESRIFPLRARSSRQWNT 431
            ...|:.:::..:..:|:.::       .:|:...:: ...|...||.|..::    .||.|:.|:
plant   387 GDILEHVAATNLSVIQRNLEDPSVRRALMFNVPSRE-GDATWQVLEALSKKL----NRSVRRSNS 446

  Fly   432  431
            plant   447  446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 73/324 (23%)
Glyco_transf_64 455..689 CDD:286358
FRA8NP_850113.2 Exostosin 94..391 CDD:281069 72/319 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.