DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and AT5G03795

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001031828.1 Gene:AT5G03795 / 3770626 AraportID:AT5G03795 Length:518 Species:Arabidopsis thaliana


Alignment Length:339 Identity:78/339 - (23%)
Similarity:132/339 - (38%) Gaps:100/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RLKVYIY-----PLQEFVDEQSDKTATTLSSEYFQILEAVLKSRYYTSNPNEACLF-LP-SLDLL 164
            :.|:|:|     ||  |.|... |:..::...:  |.|....:|:.|:||::|.:| || |:..:
plant   189 QFKIYVYKEGEPPL--FHDGPC-KSIYSMEGSF--IYEIETDTRFRTNNPDKAHVFYLPFSVVKM 248

  Fly   165 NQNVFDKHLAGAALASLDFWDRGANHIIFNMLPGGAPSYNTVLD-VNTDNAIIFGGGFDSWSYRP 228
            .:.|::::       |.||                :|..|||.| :|     :.|..:..|:...
plant   249 VRYVYERN-------SRDF----------------SPIRNTVKDYIN-----LVGDKYPYWNRSI 285

  Fly   229 GFD---VAIPVWSPRLVRQHAH-----------ATAQRKFLLVVAQLNILPRFVRTLRELSL--- 276
            |.|   ::...|.|.....|.|           |....:|         .||...::.|::|   
plant   286 GADHFILSCHDWGPEASFSHPHLGHNSIRALCNANTSERF---------KPRKDVSIPEINLRTG 341

  Fly   277 ----------AHSEQLL--------------LLGACENLDLTMRCPLSQHHKSL----EYPRLLS 313
                      ..|..:|              ||...||.|..:|.     ||.|    .|..::.
plant   342 SLTGLVGGPSPSSRPILAFFAGGVHGPVRPVLLQHWENKDNDIRV-----HKYLPRGTSYSDMMR 401

  Fly   314 RGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQKLK 378
            ..|||:......:..|.:||.:...|:||:....||.||.||::|...||.:...::.::...|.
plant   402 NSKFCICPSGYEVASPRIVEALYSGCVPVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILT 466

  Fly   379 AISSVKIVEMQKQV 392
            :||..:.:.|.::|
plant   467 SISPRQYLRMYRRV 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 74/325 (23%)
Glyco_transf_64 455..689 CDD:286358
AT5G03795NP_001031828.1 Exostosin 186..468 CDD:281069 74/325 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.