DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and rib-1

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_502180.1 Gene:rib-1 / 178080 WormBaseID:WBGene00004360 Length:382 Species:Caenorhabditis elegans


Alignment Length:362 Identity:96/362 - (26%)
Similarity:180/362 - (49%) Gaps:34/362 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NPEAEQRARNVNCTFWDCLNIYKCEHDRLKVYIYPLQEFVDEQSDKTATTLSSEYFQILEAVLKS 144
            ||..|::    .||..:|.:..||...: ||||:|:::..:|...      |..|.:||:..|:|
 Worm    22 NPTIERK----QCTMSNCFDFSKCSTSK-KVYIHPMEKRFEESPQ------SVIYSKILKHFLES 75

  Fly   145 RYYTSNPNEACLFLPSLDLLNQNVFDKHL---AGAALASLD--FWDRGANHIIFNMLPGGAPSYN 204
            .:||::|||||:||..:|..:::|..::.   ....:.|||  .|:.|.||:|||...|..|.|:
 Worm    76 NHYTNDPNEACIFLLGIDTTDRDVRSQNYVKNVNDYIESLDPSVWNNGRNHLIFNFYHGTFPDYD 140

  Fly   205 T-VLDVNTDNAIIFGGGFDSWSYRPGFDVAIPVW---------SPRLVRQHAHATAQRKFLLVVA 259
            . .|:.:|..|:|........::...|||::|::         ..:..|.......|||:|:...
 Worm   141 DHNLNFDTGEAMIARASSSENNFIKVFDVSLPLFHENHPYEIKESKSERNDDRIENQRKYLVSFK 205

  Fly   260 QLNILPRFVRTLREL--SLAHSEQLLLLGACE-NLDLTM----RCPL-SQHHKSLEYPRLLSRGK 316
            ....:.......|.|  .|.:.:.::::..|: |.|..:    ||.. :..:...||..||:...
 Worm   206 GKRYVYGIGSGTRNLVHHLHNGDDIVMVTTCKHNNDWQVYQDDRCQRDNDEYDRWEYDELLANST 270

  Fly   317 FCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQKLKAIS 381
            |||:.|..|:|....:|.:...|:||:..|:::|||.:.|||:.|::.:.|.:..|:.:.|.:.|
 Worm   271 FCLVPRGRRLGSFRFLETLRSGCVPVVISDSWILPFSETIDWNSAAIVVAERDALSIPELLMSTS 335

  Fly   382 SVKIVEMQKQVQWLFSKYFKDLKTVTLTALEVLESRI 418
            ..::.|:::..:.::..|.:.::.::...|.::..||
 Worm   336 RRRVKELRESARNVYDAYLRSIQVISDHVLRIIFKRI 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 82/297 (28%)
Glyco_transf_64 455..689 CDD:286358
rib-1NP_502180.1 Exostosin 46..333 CDD:308581 82/292 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314330at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.