DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sotv and LOC108179064

DIOPT Version :9

Sequence 1:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_021323864.1 Gene:LOC108179064 / 108179064 -ID:- Length:313 Species:Danio rerio


Alignment Length:275 Identity:79/275 - (28%)
Similarity:125/275 - (45%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LDLEHIQELAVNPEAEQRA-----RNVNCTFWDCLNIYKCE-HDRLKVYIYPLQEFVDEQSDKTA 127
            |||::......:|...::|     ::..|....|.:..:|: ....:|||||     .|:.::  
Zfish    61 LDLQNGGGPGDSPRQRKQAWSSIYKDSRCRMDTCFDFGRCQTQSGFRVYIYP-----PEKGER-- 118

  Fly   128 TTLSSEYFQILEAVLKSRYYTSNPNEACLFLPSLDLLNQ---------NVFDKHLAGAALASLDF 183
              :|..|.:||.:|.:||||||:|.|||||:..:|.|::         || |:.:.|..|     
Zfish   119 --VSESYRKILTSVSESRYYTSDPREACLFVLGIDTLDRDQLSQQFVPNV-DERIRGYPL----- 175

  Fly   184 WDRGANHIIFNMLPGGAPSYNTVLDVNTDNAIIFGGGFDSWSYRPGFDVAIPVWSPR-------- 240
            |:.|.||:|||:..|..|:|...|..|...||:.....::..:|||||::||::|..        
Zfish   176 WNDGRNHVIFNLYSGTWPNYTEDLGFNVGQAILAKASLNTEHFRPGFDISIPLFSKEHPQKGGKR 240

  Fly   241 --LVRQHAHATAQRKFLLVVAQLNILPRFVRTLRELSLAH---SEQLLLLGACEN-----LDLTM 295
              |||.  ....:||:||:......|.......|. :|.|   .:.::.|..|.:     .....
Zfish   241 GWLVRN--SVPPRRKYLLMFKGKRYLTGIGSDTRN-ALHHIHNGKDIVSLTTCRHGKDWEKHKDA 302

  Fly   296 RCPLSQHHKSLEYPR 310
            ||    .|.:.||.|
Zfish   303 RC----DHDNQEYER 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sotvNP_725536.1 Exostosin 105..380 CDD:281069 71/233 (30%)
Glyco_transf_64 455..689 CDD:286358
LOC108179064XP_021323864.1 Exostosin 103..>311 CDD:308581 68/229 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314330at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.