DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and bZIP70

DIOPT Version :10

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_200891.1 Gene:bZIP70 / 836204 AraportID:AT5G60830 Length:206 Species:Arabidopsis thaliana


Alignment Length:172 Identity:43/172 - (25%)
Similarity:70/172 - (40%) Gaps:44/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 SNANTSNTPARRGGGRRPNRSTNMTPE-----------EEQKRAVRRERNKQAAARCRKRRVDQT 443
            ||.:|           |.|..:::.|.           .|::||.|...|:::|.|.|.|:..|.
plant    41 SNVST-----------RINNQSHLDPNAENIFHNEGLAPEERRARRMVSNRESARRSRMRKKKQI 94

  Fly   444 NELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLL 508
            .||.::||||......:.:::..|..|.:|   :|..:....:|:.|..|       |:|.. ||
plant    95 EELQQQVEQLMMLNHHLSEKVINLLESNHQ---ILQENSQLKEKVSSFHL-------LMADV-LL 148

  Fly   509 SAGSSGS-----------GASSHHNHNSNDSSNGTITGMDAT 539
            ...::.|           |..|:...||..:|:..|..|.||
plant   149 PMRNAESNINDRNVNYLRGEPSNRPTNSPFASSTMIDAMYAT 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 19/60 (32%)
coiled coil 421..480 CDD:269869 19/58 (33%)
bZIP70NP_200891.1 bZIP_plant_GBF1 72..123 CDD:269850 17/50 (34%)
coiled coil 72..123 CDD:269850 17/50 (34%)

Return to query results.
Submit another query.