DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and ABF3

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001320130.1 Gene:ABF3 / 829547 AraportID:AT4G34000 Length:454 Species:Arabidopsis thaliana


Alignment Length:211 Identity:52/211 - (24%)
Similarity:84/211 - (39%) Gaps:35/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 DVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQD-------------TTDTS 344
            |:.|.|:... ..|...||..|.:.|....:.........|:.:.|:             |.|..
plant   225 DLSGNGVAVR-QDLLTAQTQPLQMQQPQMVQQPQMVQQPQQLIQTQERPFPKQTTIAFSNTVDVV 288

  Fly   345 SAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRG----SASVGSS-----------NANT 394
            :....:|..|........::...:||  |:|.||....|    :.|.||.           :|:.
plant   289 NRSQPATQCQEVKPSILGIHNHPMNN--NLLQAVDFKTGVTVAAVSPGSQMSPDLTPKSALDASL 351

  Fly   395 SNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGES 459
            |..|...|..|:.........|..|||.:   :|:::|||.|.|:...|.||..|:.||::..|.
plant   352 SPVPYMFGRVRKTGAVLEKVIERRQKRMI---KNRESAARSRARKQAYTMELEAEIAQLKELNEE 413

  Fly   460 M-RKEIEVLTNSKNQL 474
            : :|::|::...||||
plant   414 LQKKQVEIMEKQKNQL 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 21/56 (38%)
coiled coil 421..480 CDD:269869 20/55 (36%)
ABF3NP_001320130.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.