Sequence 1: | NP_001027577.2 | Gene: | kay / 3772082 | FlyBaseID: | FBgn0001297 | Length: | 755 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083243.1 | Gene: | Batf2 / 74481 | MGIID: | 1921731 | Length: | 277 | Species: | Mus musculus |
Alignment Length: | 270 | Identity: | 58/270 - (21%) |
---|---|---|---|
Similarity: | 95/270 - (35%) | Gaps: | 61/270 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 417 EEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATH 481
Fly 482 RATCQKIRSDMLSVVTCN--GLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTG 544
Fly 545 RSNSPLDLKPAANIDSLLMHIKDEP---------------LDGAIDSGSSL-------------- 580
Fly 581 -DQDGPPPSKR---------------ITLPPMSTMPHVHLSTILTPTGASSGSLQTPITSTAPGG 629
Fly 630 FGSAFPVTSN 639 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kay | NP_001027577.2 | bZIP_Fos | 420..481 | CDD:269869 | 17/60 (28%) |
coiled coil | 421..480 | CDD:269869 | 16/58 (28%) | ||
Batf2 | NP_083243.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 15..50 | 9/32 (28%) | |
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 20..42 | 6/21 (29%) | |||
bZIP_BATF | 28..74 | CDD:269849 | 15/45 (33%) | ||
coiled coil | 28..74 | CDD:269849 | 15/45 (33%) | ||
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 46..67 | 9/20 (45%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 126..146 | 2/19 (11%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 191..256 | 12/68 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1414 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |