DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and ATF3

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001025458.1 Gene:ATF3 / 467 HGNCID:785 Length:181 Species:Homo sapiens


Alignment Length:159 Identity:45/159 - (28%)
Similarity:69/159 - (43%) Gaps:41/159 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 GHIMAGSVNGGGV------------NNFSNVLAAV-----------------SSSRGSASVGSSN 391
            |.:.|..|:...:            .:|:|:...|                 ||:..|.:|....
Human     7 GQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRP 71

  Fly   392 ANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKR 456
            ...|.|.|            .:.|||::::..||||||.|||:||.::.::|..|.:|.|:||..
Human    72 LGVSITKA------------EVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESV 124

  Fly   457 GESMRKEIEVLTNSKNQLEYLLATHRATC 485
            ...::.:||.|.|.|..|.|:|..||.||
Human   125 NAELKAQIEELKNEKQHLIYMLNLHRPTC 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 25/60 (42%)
coiled coil 421..480 CDD:269869 25/58 (43%)
ATF3NP_001025458.1 Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 88..110 11/21 (52%)
bZIP_ATF3 96..149 CDD:269870 21/52 (40%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 114..142 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.