DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and atf1

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001005828.1 Gene:atf1 / 448303 XenbaseID:XB-GENE-971677 Length:281 Species:Xenopus tropicalis


Alignment Length:289 Identity:60/289 - (20%)
Similarity:114/289 - (39%) Gaps:87/289 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LQQLGNFETGQSVLTLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVLG 296
            :|..|..:|.||...:.:|.::.....::.::     .|:|.    .|.....|.        .|
 Frog    18 IQVQGVIQTAQSSTVIHSPQVSAAQASSLSES-----EDSQD----SCDSIETPH--------KG 65

  Fly   297 MGIPTGVSSLPLQQTF--DLSLGQGSESEDSNASYNDTQMNEEQD--------TTDTSSAHTDST 351
            .||   :|..|..:..  |||      |||:    .|.:.||:..        ::.|:...|.|.
 Frog    66 HGI---LSRRPSYRKIFNDLS------SEDA----GDRKRNEDSPGVSAVIPMSSGTTIYQTSSG 117

  Fly   352 SYQA----GHIMAGSVNGGGVNNFSNVLAAVS-SSRGSASVGSS---NANTSN-----TPARR-- 401
            .|..    |.:...:.:|.||::    |.|:| ::.|:|..|::   .|.||:     .|:.:  
 Frog   118 QYVTIAPNGTLQFATTSGDGVHS----LQALSMANAGNAQSGTAILQYAQTSDGQQILVPSNQVV 178

  Fly   402 ---GGG-------RRPNRSTNM------------------TPEEEQKRAVRRERNKQAAARCRKR 438
               ..|       |..:.:|::                  |.:.:.||.:|..:|::||..||::
 Frog   179 VQTASGDMQAYQIRTTSTTTSLPQTVVMTSPVALSSPATKTDDPQLKREIRLLKNREAARECRRK 243

  Fly   439 RVDQTNELTEEVEQLEKRGESMRKEIEVL 467
            :.:....|...|..||.:.:::.:|::.|
 Frog   244 KKEYVKCLENRVAVLENQNKTLIEELKTL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 14/48 (29%)
coiled coil 421..480 CDD:269869 13/47 (28%)
atf1NP_001005828.1 FRQ <32..155 CDD:370478 32/156 (21%)
pKID 54..94 CDD:366954 14/64 (22%)
bZIP_CREB1 225..279 CDD:269838 14/48 (29%)
coiled coil 226..278 CDD:269838 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.