DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and jdp2b

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001002493.1 Gene:jdp2b / 436766 ZFINID:ZDB-GENE-040718-197 Length:156 Species:Danio rerio


Alignment Length:87 Identity:34/87 - (39%)
Similarity:53/87 - (60%) Gaps:6/87 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 RSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQ 473
            :|.:...:|.:||  |||:||.||||||.|:.::|:.|.:|.|:||.....::.:||.|.:.:.|
Zfish    63 KSEDDDDDERKKR--RREKNKVAAARCRNRKKERTDFLQKESERLEMLNSDLKSQIEELKSERQQ 125

  Fly   474 LEYLLATHRATC----QKIRSD 491
            |..:|..||.||    ..::||
Zfish   126 LIVMLNLHRPTCIVRTDSVKSD 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 26/60 (43%)
coiled coil 421..480 CDD:269869 25/58 (43%)
jdp2bNP_001002493.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..95 16/33 (48%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 72..94 14/23 (61%)
bZIP_ATF3 80..133 CDD:269870 21/52 (40%)
coiled coil 80..130 CDD:269870 20/49 (41%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 98..126 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.