DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and fosab

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_991132.1 Gene:fosab / 394198 ZFINID:ZDB-GENE-031222-4 Length:349 Species:Danio rerio


Alignment Length:368 Identity:109/368 - (29%)
Similarity:165/368 - (44%) Gaps:66/368 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 TQMNEEQDTT---DTSSAHTDSTSY----QAGHIMAGSVNGGGVNNFSNVLAAVSSSRG------ 383
            |.:|.:.|.:   .|:|...||..|    |.......||:..   :|...:.|:||...      
Zfish     4 TSLNADCDASSRCSTASPSGDSVGYYPLNQTQEFTDLSVSSA---SFVPTVTAISSCPDLQWMVQ 65

  Fly   384 --SASVGSSNA-----NTSNTPARRGGG----RRPNRSTNMTPEEEQKRAVRRERNKQAAARCRK 437
              .:||..||.     |.|:.|..|..|    .:.:||..::||||:|:.|||||||.|||:||.
Zfish    66 PMISSVAPSNGAAQSYNPSSYPKMRVTGAKTSNKRSRSEQLSPEEEEKKRVRRERNKMAAAKCRN 130

  Fly   438 RRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLI 502
            ||.:.|:.|..|.:|||....:::.:|..|...|.:||::||.|:..| ||.:|.......:   
Zfish   131 RRRELTDTLQAETDQLEDEKSALQNDIANLLKEKERLEFILAAHKPIC-KIPADASFPEPSS--- 191

  Fly   503 APAGLLSAGS--SGSGASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPL-DLKPAANIDSLLMH 564
            :|.|.:|...  :.|..||..|.:...||:..:....|:.:|...:...: ||:|... :||.:.
Zfish   192 SPMGSISVPEIVTTSVVSSTPNTSITTSSSSLLFSSTASTDSFSSTTVKISDLEPTLE-ESLELL 255

  Fly   565 IKDEPLDGA-----IDSGSSL-DQDGPPPSKRITLPPMSTMPHVHLSTILTPTGASSGSLQTPIT 623
            .|.| |:.|     :|..:|| .||         ..|:.|..:..|..:.||....     ||..
Zfish   256 AKAE-LETARSVPDMDLSNSLYTQD---------WEPLYTPANTDLEPLCTPVVTC-----TPAC 305

  Fly   624 STAPGGFGSAFP--------VTSNGSSINNINSIGNNMNSPTL 658
            :|....|...:|        |...|||.|:.:|  :::|||||
Zfish   306 TTYTSSFMFTYPENDVFPTSVHRRGSSSNDQSS--DSLNSPTL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 28/60 (47%)
coiled coil 421..480 CDD:269869 26/58 (45%)
fosabNP_991132.1 bZIP_Fos 113..174 CDD:269869 28/60 (47%)
coiled coil 114..173 CDD:269869 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10618
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002314
OrthoInspector 1 1.000 - - otm24837
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.