DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and atf3

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_957258.1 Gene:atf3 / 393939 ZFINID:ZDB-GENE-040426-728 Length:202 Species:Danio rerio


Alignment Length:136 Identity:49/136 - (36%)
Similarity:69/136 - (50%) Gaps:18/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 GSVNGGGVNNFSNVLA-----AVSSSRGSASVGSSNANTS----NT--PARRGGGRRPNRSTNMT 414
            ||:......||:.::.     |:.:.|  .|.|.|...|.    ||  |....|.:|     ...
Zfish    26 GSLTLDDFTNFTPLVKEELRYAIQNKR--MSNGMSTLTTDRACMNTERPTELPGMKR-----EAV 83

  Fly   415 PEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLA 479
            |||..:|..||||||.|||:||.::.::|:.|.:|.|:||.....::.:||.|.|.|.||.|:|.
Zfish    84 PEENDRRKRRRERNKIAAAKCRNKKKEKTDNLQKESEKLESINAELKAQIEELKNQKQQLVYMLN 148

  Fly   480 THRATC 485
            .||.||
Zfish   149 LHRPTC 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 27/60 (45%)
coiled coil 421..480 CDD:269869 27/58 (47%)
atf3NP_957258.1 bZIP_ATF3 99..150 CDD:269870 20/50 (40%)
coiled coil 99..147 CDD:269870 19/47 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.