DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and Atf-2

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001033973.1 Gene:Atf-2 / 37978 FlyBaseID:FBgn0265193 Length:381 Species:Drosophila melanogaster


Alignment Length:389 Identity:79/389 - (20%)
Similarity:136/389 - (34%) Gaps:94/389 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 TCNTTAAATTSTTATSAAAGSDNNHSDN-FAMDASEIATFLANE-----LF--LQQLGNFETG-- 241
            :|.....|.|...:...:.|   ..||. ||.|.:...|.|...     ||  ||.:..|:.|  
  Fly    28 SCYQNFRAQTEHVSLDISLG---QKSDTLFAADQTPTPTRLIKNCDEVGLFEDLQHVNPFDIGFQ 89

  Fly   242 ----QSVL--------------TLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVL 288
                ::|.              :|.||.:.|...    .|:..:.|:.|..:...|....|.::|
  Fly    90 QAAERNVSGTPSRPEARPNDGESLHTPQVYPVEA----PTVVSVPSENQVPQSVSCGDMDVDQLL 150

  Fly   289 PNAIDVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDT--------TDTSS 345
            ...:.........|...|.|.|...|:....::|...:.:..|...|..:.|        ...::
  Fly   151 ATTVTSPSKASQDGPPPLQLIQPQVLTWVLPAQSVPISIATVDCNRNRVKPTGAIHPFILPKPTA 215

  Fly   346 AHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSS------RGSASVGSSNANTSNTPARRGGG 404
            ...:.||.:...|:   |:....||..:..:...:|      |..|.:.|:|             
  Fly   216 KELNKTSKRPEPIL---VSCNPPNNEPSSASLTPTSQLPIKERLKAIIHSNN------------- 264

  Fly   405 RRPNRSTNMTPEEEQKRAVR------RERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKE 463
               ||.:..||.:..|...|      .||.:.||:|.|.:..::..:|.::..||::..:.:.:.
  Fly   265 ---NRRSFSTPPKAAKAKDRSRDEDCMERRRAAASRYRNKMRNEHKDLIKQNAQLQQENQELHER 326

  Fly   464 IEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGL--------LSAGSSGSGASS 519
            |       ::||..|..||:     .|.:..||.....|.|:.:        :...||.|.||:
  Fly   327 I-------SRLEKELQQHRS-----HSSLAGVVADQLRIPPSSIHLLINVPNVLVPSSASNASA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 15/66 (23%)
coiled coil 421..480 CDD:269869 14/64 (22%)
Atf-2NP_001033973.1 Cnn_1N <300..336 CDD:285263 7/42 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.