DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and atf1

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_956017.1 Gene:atf1 / 325609 ZFINID:ZDB-GENE-030131-4334 Length:304 Species:Danio rerio


Alignment Length:318 Identity:76/318 - (23%)
Similarity:114/318 - (35%) Gaps:111/318 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 QLGNFETGQSVLTLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVLGMG 298
            |..|....|.|...||.|.:            ||....|..  .|....||.::......|.|: 
Zfish     5 QHNNGSESQPVSVATTITAS------------HLSQIAQMS--LGGNPVAVVQLPSGQFQVQGV- 54

  Fly   299 IPTGVSSL----PLQQTFDLSLGQGSESEDSNAS-----------------------YND----- 331
            |.:..||:    |:|     |.||||:|:||..|                       .||     
Zfish    55 IQSAQSSVIQSPPVQ-----SQGQGSDSDDSQESSDSGASNQKSREILARRPSYRKILNDLSAEE 114

  Fly   332 --TQMNEEQDTTDTSSAHTD----STSYQ--AGHIMAGSVNGGGVNNFSNVLAAVSSS--RGSAS 386
              || ||.::.:.||||.|.    :..||  .|..:|.|.||      |..||:..|.  :|..:
Zfish   115 LATQ-NEGEEESSTSSAITSVSLPTPIYQTSTGQYIAISSNG------SLQLASAGSEGVQGLQT 172

  Fly   387 VGSSNAN--------------------TSNTPARRGGG--------RRPNRSTNMT--------- 414
            :..||:|                    .||....:|.|        |..:.|...|         
Zfish   173 LTMSNSNPSQPTILQYAQTADGQQILLPSNQVVLQGAGGEMQAYQIRSSSSSLPQTVVMTSPVIN 237

  Fly   415 -----PEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVL 467
                 .:.:.||.:|..:|::||..||:::.:....|...|..||.:.:::.:|::.|
Zfish   238 SQGKSDDPQMKREIRLAKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 14/48 (29%)
coiled coil 421..480 CDD:269869 13/47 (28%)
atf1NP_956017.1 pKID 87..118 CDD:280355 2/30 (7%)
bZIP_CREB1 248..302 CDD:269838 14/48 (29%)
coiled coil 249..301 CDD:269838 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.