Sequence 1: | NP_001027577.2 | Gene: | kay / 3772082 | FlyBaseID: | FBgn0001297 | Length: | 755 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956017.1 | Gene: | atf1 / 325609 | ZFINID: | ZDB-GENE-030131-4334 | Length: | 304 | Species: | Danio rerio |
Alignment Length: | 318 | Identity: | 76/318 - (23%) |
---|---|---|---|
Similarity: | 114/318 - (35%) | Gaps: | 111/318 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 234 QLGNFETGQSVLTLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVLGMG 298
Fly 299 IPTGVSSL----PLQQTFDLSLGQGSESEDSNAS-----------------------YND----- 331
Fly 332 --TQMNEEQDTTDTSSAHTD----STSYQ--AGHIMAGSVNGGGVNNFSNVLAAVSSS--RGSAS 386
Fly 387 VGSSNAN--------------------TSNTPARRGGG--------RRPNRSTNMT--------- 414
Fly 415 -----PEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVL 467 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kay | NP_001027577.2 | bZIP_Fos | 420..481 | CDD:269869 | 14/48 (29%) |
coiled coil | 421..480 | CDD:269869 | 13/47 (28%) | ||
atf1 | NP_956017.1 | pKID | 87..118 | CDD:280355 | 2/30 (7%) |
bZIP_CREB1 | 248..302 | CDD:269838 | 14/48 (29%) | ||
coiled coil | 249..301 | CDD:269838 | 13/47 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R103 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |