DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and Batf

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001100218.1 Gene:Batf / 299206 RGDID:1304923 Length:125 Species:Rattus norvegicus


Alignment Length:144 Identity:37/144 - (25%)
Similarity:67/144 - (46%) Gaps:27/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 SVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEV 450
            |..||:::.|.:|.       |.:..:   .::.::..|||:|:.||.:.|:|:..:.:.|..|.
  Rat     4 SSDSSDSSFSRSPP-------PGKQDS---SDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLES 58

  Fly   451 EQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGS 515
            |.|||:..::||||:.||........:|::|...|.         |..:|..:|..::       
  Rat    59 EDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCS---------VLASGTPSPPEVV------- 107

  Fly   516 GASSHHNHNSNDSS 529
             .|:|..|..:.||
  Rat   108 -YSAHAFHQPHISS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 21/60 (35%)
coiled coil 421..480 CDD:269869 21/58 (36%)
BatfNP_001100218.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59 16/64 (25%)
bZIP_BATF 26..83 CDD:269849 20/56 (36%)
Basic motif 28..50 8/21 (38%)
coiled coil 29..80 CDD:269849 20/50 (40%)
Leucine-zipper 54..75 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.