DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and pcr1

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_594500.1 Gene:pcr1 / 2542047 PomBaseID:SPAC21E11.03c Length:171 Species:Schizosaccharomyces pombe


Alignment Length:192 Identity:39/192 - (20%)
Similarity:72/192 - (37%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 EEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQ----LEYL 477
            :::||....|||:.||::.|:::    .|..:|:||.........|.:::|.:...|    |:..
pombe     9 DDEKRRRILERNRIAASKFRQKK----KEWIKELEQTANAAFEQSKRLQLLLSQLQQEAFRLKSQ 69

  Fly   478 LATHRATCQ---KIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDAT 539
            |..|:. ||   ||||.:....|.                        ||:              
pombe    70 LLAHQG-CQCSVKIRSVLTDFQTA------------------------HNA-------------- 95

  Fly   540 LNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPH 601
            |:|...:..|:...|..|:...::.:....:..::        .|.||::...:||.|..|:
pombe    96 LHSQHMAYRPVQPPPGDNMLESVVSVSPTQMHPSL--------QGLPPNQHPQMPPSSQQPN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 17/64 (27%)
coiled coil 421..480 CDD:269869 16/62 (26%)
pcr1NP_594500.1 bZIP_ATF2 12..72 CDD:269835 17/63 (27%)
coiled coil 12..72 CDD:269835 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.