DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and FOSL2

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_006712039.1 Gene:FOSL2 / 2355 HGNCID:3798 Length:343 Species:Homo sapiens


Alignment Length:412 Identity:100/412 - (24%)
Similarity:143/412 - (34%) Gaps:151/412 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 YNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSNAN 393
            |.|...|.:..:..:|.:...:.||.:|        |||...|    .......|||.:.:.||.
Human     2 YQDYPGNFDTSSRGSSGSPAHAESYSSG--------GGGQQKF----RVDMPGSGSAFIPTINAI 54

  Fly   394 T-----------------SNTPAR--------------------RGG---------GRRPNRSTN 412
            |                 ||...|                    |.|         ||| .|...
Human    55 TTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRR-RRDEQ 118

  Fly   413 MTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELT-----------------EEVEQLEKRGESM 460
            ::||||:||.:||||||.|||:||.||.:.|.:|.                 :|.|:||:....:
Human   119 LSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAIGPWQVAVPHIPLFPWQETEELEEEKSGL 183

  Fly   461 RKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNS 525
            :|||..|...|.:||::|..|...|:....:..|        .||..|....||.|         
Human   184 QKEIAELQKEKEKLEFMLVAHGPVCKISPEERRS--------PPAPGLQPMRSGGG--------- 231

  Fly   526 NDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKR 590
               |.|.:.                              :|.|||:....|.||...|   .::|
Human   232 ---SVGAVV------------------------------VKQEPLEEDSPSSSSAGLD---KAQR 260

  Fly   591 ITLPPMSTM------PHVHLSTILTPTGASSGSLQTPITS----TAPGGFGSAFPVTSNGS---- 641
            ..:.|:|..      ..:|...::|.|.|     .||.||    |.|.......|.:.:.|    
Human   261 SVIKPISIAGGFYGEEPLHTPIVVTSTPA-----VTPGTSNLVFTYPSVLEQESPASPSESCSKA 320

  Fly   642 ---SINNINSIGNNMNSPTLNA 660
               |.::.:...:::|||||.|
Human   321 HRRSSSSGDQSSDSLNSPTLLA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/77 (38%)
coiled coil 421..480 CDD:269869 28/75 (37%)
FOSL2XP_006712039.1 bZIP_Fos 134..204 CDD:269869 23/69 (33%)
coiled coil 134..195 CDD:269869 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42280
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.