DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and CREB1

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001358355.1 Gene:CREB1 / 1385 HGNCID:2345 Length:341 Species:Homo sapiens


Alignment Length:437 Identity:84/437 - (19%)
Similarity:146/437 - (33%) Gaps:125/437 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QQQQQQQAPQQQLRHQQRQLPTQPAYQQSQSVAHNAFPLRSSSNNYGHVASSAYAASSGSHNSNN 108
            :.||...|...:..:||..:..||                       .:|:.|..:...:|.:::
Human     8 ENQQSGDAAVTEAENQQMTVQAQP-----------------------QIATLAQVSMPAAHATSS 49

  Fly   109 AAAMAAVCQMQNFFNQQQQQQQQLEFNNNCMPINYYQQQQQQHYPSESQSSASGWNPETPGQAQL 173
            |..:..|               ||. |...:.::...|..|   ||..||.          |.| 
Human    50 APTVTLV---------------QLP-NGQTVQVHGVIQAAQ---PSVIQSP----------QVQ- 84

  Fly   174 ALTATTCNTTAAATCNTTAAATTSTTATSAAAGSDNNHSDNFAMDASEIATFLA---------NE 229
                     |..::|.......:.|..::.|...|:..|.:...|:.:....|:         |:
Human    85 ---------TVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILND 140

  Fly   230 LFLQQLG--NFETGQSVLTLTTPTLTPTT--TRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPN 290
            |.....|  ..|..:|....:.|.:|..|  |...:.:.|..::.||        |.|: ::..|
Human   141 LSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQ--------GGAI-QLANN 196

  Fly   291 AIDVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQA 355
            ..|        ||..|   ||..::        ::.|:...|.:.:...|||.......|.... 
Human   197 GTD--------GVQGL---QTLTMT--------NAAATQPGTTILQYAQTTDGQQILVPSNQVV- 241

  Fly   356 GHIMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQK 420
              :.|.|   |.|..:....|..|:......:.||                |...|....|..:|
Human   242 --VQAAS---GDVQTYQIRTAPTSTIAPGVVMASS----------------PALPTQPAEEAARK 285

  Fly   421 RAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVL 467
            |.||..:|::||..||:::.:....|...|..||.:.:::.:|::.|
Human   286 REVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKAL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 15/48 (31%)
coiled coil 421..480 CDD:269869 14/47 (30%)
CREB1NP_001358355.1 pKID 113..151 CDD:396650 6/37 (16%)
bZIP_CREB1 285..339 CDD:269838 15/48 (31%)
coiled coil 286..337 CDD:269838 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.