powered by:
Protein Alignment kay and atf3
DIOPT Version :9
Sequence 1: | NP_001027577.2 |
Gene: | kay / 3772082 |
FlyBaseID: | FBgn0001297 |
Length: | 755 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002934744.1 |
Gene: | atf3 / 100494437 |
XenbaseID: | XB-GENE-6085251 |
Length: | 181 |
Species: | Xenopus tropicalis |
Alignment Length: | 75 |
Identity: | 33/75 - (44%) |
Similarity: | 47/75 - (62%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 411 TNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLE 475
|...|||:.::..||||||.|||:||.::.::|..|.:|.|:||.....::.:||.|.|.|..|.
Frog 79 TEFVPEEDDRKKRRRERNKVAAAKCRNKKKEKTESLQKESEKLESINADLKAQIEELKNEKQHLI 143
Fly 476 YLLATHRATC 485
|:|..||.||
Frog 144 YMLNLHRPTC 153
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.