DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and atf3

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_002934744.1 Gene:atf3 / 100494437 XenbaseID:XB-GENE-6085251 Length:181 Species:Xenopus tropicalis


Alignment Length:75 Identity:33/75 - (44%)
Similarity:47/75 - (62%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 TNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLE 475
            |...|||:.::..||||||.|||:||.::.::|..|.:|.|:||.....::.:||.|.|.|..|.
 Frog    79 TEFVPEEDDRKKRRRERNKVAAAKCRNKKKEKTESLQKESEKLESINADLKAQIEELKNEKQHLI 143

  Fly   476 YLLATHRATC 485
            |:|..||.||
 Frog   144 YMLNLHRPTC 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 25/60 (42%)
coiled coil 421..480 CDD:269869 25/58 (43%)
atf3XP_002934744.1 bZIP_ATF3 96..149 CDD:269870 21/52 (40%)
coiled coil 96..146 CDD:269870 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.