DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and batf

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_002938637.1 Gene:batf / 100492340 XenbaseID:XB-GENE-6258076 Length:115 Species:Xenopus tropicalis


Alignment Length:79 Identity:25/79 - (31%)
Similarity:41/79 - (51%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 PNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSK 471
            |..|......::.|:..|||:|:.||.:.|:|:..:.:.|..|.|.||:...::|.||..|....
 Frog    16 PPSSNKQDSSDDTKKIQRREKNRIAAQKSRQRQTQKADSLHIESENLERLNSALRGEISGLREEL 80

  Fly   472 NQLEYLLATHRATC 485
            ..|..:|:||:..|
 Frog    81 KYLTCVLSTHQPVC 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 20/60 (33%)
coiled coil 421..480 CDD:269869 19/58 (33%)
batfXP_002938637.1 bZIP_BATF 27..84 CDD:269849 18/56 (32%)
coiled coil 29..83 CDD:269849 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.