DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and fosb

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_002932681.3 Gene:fosb / 100490871 XenbaseID:XB-GENE-6258697 Length:297 Species:Xenopus tropicalis


Alignment Length:382 Identity:87/382 - (22%)
Similarity:129/382 - (33%) Gaps:147/382 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 QDTTDTSSAHTDSTSYQAGHIMAGSVNGGGV-----------NNFSNVLAAVSSSRGSASV---- 387
            |....:||:.:..:.|.:.....||....|:           .:|...:.|::||:....:    
 Frog     3 QGYDSSSSSPSAESQYLSSVDSFGSPQAAGIPQECAALCDAPTSFVPTVTAITSSQDLQWLVTPA 67

  Fly   388 ----------------------GSSNANTSNT----------PAR------RGGGRRPNRSTNMT 414
                                  |.|.|:.|.|          |.:      |..|:|......:|
 Frog    68 LISSMAQSQPTSGPPIDPYDLPGPSYASPSGTTYGHTLTEAAPEQEEVRPSRARGKRTREEAALT 132

  Fly   415 PEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLA 479
            ||||:||.|||||||.|||:||.||.:.|:.|..|.:.||:...::..||:.|...|.|||:.|.
 Frog   133 PEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQSETDILEEEKSTLEAEIDELRRQKEQLEFALL 197

  Fly   480 THRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTG 544
            :||..| |:..|.:.:.|                 :..|:.:.|                     
 Frog   198 SHRPGC-KLPYDDIDLPT-----------------TDPSTSYPH--------------------- 223

  Fly   545 RSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTILT 609
                                       ||:                  ||...|.|.|.....|.
 Frog   224 ---------------------------GAL------------------LPTYPTQPEVSFPICLP 243

  Fly   610 P-----TGASSGSLQTPITSTAP-GGFGSAFPVTSNGSSINNINSIGNNMNSPTLNA 660
            |     ...|.||..:....|:| ||...|....|:||.    .|..::::||:|.|
 Frog   244 PLPDSDCATSVGSYTSSFVFTSPEGGACGARYQRSSGSE----RSSSDSLSSPSLLA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/60 (48%)
coiled coil 421..480 CDD:269869 28/58 (48%)
fosbXP_002932681.3 bZIP_Fos 146..199 CDD:269869 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10394
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49511
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.