DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and Fosb

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001243438.1 Gene:Fosb / 100360880 RGDID:1308198 Length:338 Species:Rattus norvegicus


Alignment Length:414 Identity:102/414 - (24%)
Similarity:140/414 - (33%) Gaps:152/414 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 CAGFA------VPKV--LPNAIDVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMN 335
            |||..      ||.|  :..:.|:..:..||.:||:...|      ||...|:.......|    
  Rat    44 CAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQ------GQPLASQPPAVDPYD---- 98

  Fly   336 EEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPAR 400
                        ...|||....:.|.|..|            .|.|.|.::..|::...|..|| 
  Rat    99 ------------MPGTSYSTPGLSAYSTGG------------ASGSGGPSTSTSTSGPVSARPA- 138

  Fly   401 RGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIE 465
            |...|||...| :|||||:||.|||||||.|||:||.||.:.|:.|..|.:|||:....:..||.
  Rat   139 RARPRRPREET-LTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIA 202

  Fly   466 VLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSN 530
            .|...|.:||::|..|:..| ||..:                     .|.|...           
  Rat   203 ELQKEKERLEFVLVAHKPGC-KIPYE---------------------EGPGPGP----------- 234

  Fly   531 GTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDG---------PP 586
                                           |..::|.|      ..:|..:||         ||
  Rat   235 -------------------------------LAEVRDLP------GSTSAKEDGFGWLLPPPPPP 262

  Fly   587 P----SKRITLPPMSTMPHVHLST--------ILTPTGASSGSLQTPITSTAPGG---FGSAFPV 636
            |    |.|...|.::.....|...        :::|:..||..|..|..|...|.   .||..| 
  Rat   263 PLPFQSSRDAPPNLTASLFTHSEVQVLGDPFPVVSPSYTSSFVLTCPEVSAFAGSQRTSGSEQP- 326

  Fly   637 TSNGSSINNINSIGNNMNSPTLNA 660
                         .:.:|||:|.|
  Rat   327 -------------SDPLNSPSLLA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/60 (48%)
coiled coil 421..480 CDD:269869 28/58 (48%)
FosbNP_001243438.1 bZIP_Fos 165..218 CDD:269869 22/52 (42%)
coiled coil 165..209 CDD:269869 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.