DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kay and fosl1

DIOPT Version :9

Sequence 1:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_002939377.3 Gene:fosl1 / 100038288 XenbaseID:XB-GENE-6257957 Length:298 Species:Xenopus tropicalis


Alignment Length:317 Identity:81/317 - (25%)
Similarity:110/317 - (34%) Gaps:123/317 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 QDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRG-----SASVGSSNANTSNT 397
            :|.......||.|                  ..|...|.|::||:.     ..||...|.....:
 Frog    46 EDAQQKYPVHTSS------------------GQFIPTLNAITSSQDLNWMIQPSVRPLNLPPYQS 92

  Fly   398 P-----ARRGG----GRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQL 453
            |     ...||    |||.| ..:::||||::|.|||||||.|||:||.||.:.|:.|..|.::|
 Frog    93 PRHGVIRNMGGVLSMGRRRN-GEHLSPEEEERRRVRRERNKVAAAKCRNRRKELTDYLQAETDKL 156

  Fly   454 EKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGAS 518
            |:...|::|||..|...|::||.:|..|:..|:                             ...
 Frog   157 EEEKSSLQKEIAELQKQKDKLELILEAHQPICK-----------------------------FPD 192

  Fly   519 SHHNHNSNDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQD 583
            ||||....|||.                                 .:|.||           .::
 Frog   193 SHHNMQQVDSSR---------------------------------LVKKEP-----------HEE 213

  Fly   584 GPPPSKRITLPPMSTMPHVHLS-TILTPTGASSGSLQTPITSTAPGGFGSAFPVTSN 639
            .|       ..|...:|.:.|| |||.|.     :|.||.....|    |..|.|.|
 Frog   214 SP-------RGPKVNLPRIELSDTILEPE-----ALHTPTLMKTP----SITPFTPN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/60 (48%)
coiled coil 421..480 CDD:269869 29/58 (50%)
fosl1XP_002939377.3 bZIP_Fos 131..184 CDD:269869 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10394
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002314
OrthoInspector 1 1.000 - - otm49511
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.