DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33870 and H2bc21

DIOPT Version :10

Sequence 1:NP_001027380.1 Gene:His2B:CG33870 / 3772081 FlyBaseID:FBgn0053870 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_835586.2 Gene:H2bc21 / 319190 MGIID:2448415 Length:126 Species:Mus musculus


Alignment Length:45 Identity:9/45 - (20%)
Similarity:20/45 - (44%) Gaps:4/45 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NDLRAKEMELQAKENELKRKEQELKRR----EDAIARTGVVIEEK 93
            ||..:....:..:..:|:..::|..::    .|.||.....:||:
Mouse    89 NDFPSVNEAISLRNQQLRTLQEECDKKLISLRDEIAIDLYELEEE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33870NP_001027380.1 HFD_H2B 33..120 CDD:467035 9/45 (20%)
H2bc21NP_835586.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
HFD_H2B 30..123 CDD:467035 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.