DRSC - DRSC Integrative Ortholog Prediction Tool

DRSC/TRiP Functional Genomics Resources

powered by:

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment His2B:CG33870 and H2bc22

DIOPT Version :10

Sequence 1:	NP_001027380.1	Gene:	His2B:CG33870 / 3772081	FlyBaseID:	FBgn0053870	Length:	123	Species:	Drosophila melanogaster
Sequence 2:	NP_835509.2	Gene:	H2bc22 / 319188	MGIID:	2448409	Length:	138	Species:	Mus musculus

Alignment Length:	39	Identity:	10/39 - (25%)
Similarity:	18/39 - (46%)	Gaps:	15/39 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly    57 AKEMELQAKENELKRKEQELKRREDAIARTGVVIEEKNW 95
            :::.:.:|:.||::|      ||.|.|         .||
Mouse   173 SRDEKRRAQHNEVER------RRRDKI---------NNW 196

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
His2B:CG33870	NP_001027380.1	HFD_H2B	33..120	CDD:467035	10/39 (26%)
H2bc22	NP_835509.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..36
H2bc22	NP_835509.2	HFD_H2B	30..123	CDD:467035
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.