DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33870 and H2bc14

DIOPT Version :10

Sequence 1:NP_001027380.1 Gene:His2B:CG33870 / 3772081 FlyBaseID:FBgn0053870 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_835507.1 Gene:H2bc14 / 319186 MGIID:2448404 Length:126 Species:Mus musculus


Alignment Length:85 Identity:19/85 - (22%)
Similarity:37/85 - (43%) Gaps:13/85 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 INPFANHTSVPPASNSYLKPLPPEPYDRGATVDIPLDSGNDLRA-KEMELQAKENELKRKEQELK 77
            ::|...|:||..:|.|..         :|.:::..:.|..||.| |:.::..|.   ::...||.
Mouse   264 VSPAIQHSSVISSSQSAF---------QGPSLEEKMFSSCDLTADKKAQVSFKP---RQALSELN 316

  Fly    78 RREDAIARTGVVIEEKNWPE 97
            .|....|:.....:.:||.:
Mouse   317 PRAQVTAQFHSSTKARNWAQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33870NP_001027380.1 HFD_H2B 33..120 CDD:467035 13/66 (20%)
H2bc14NP_835507.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
HFD_H2B 30..123 CDD:467035
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.