DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33870 and H2bc13

DIOPT Version :10

Sequence 1:NP_001027380.1 Gene:His2B:CG33870 / 3772081 FlyBaseID:FBgn0053870 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_835506.1 Gene:H2bc13 / 319185 MGIID:2448403 Length:126 Species:Mus musculus


Alignment Length:80 Identity:20/80 - (25%)
Similarity:29/80 - (36%) Gaps:16/80 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NHTSVPPASNSYLKPLPPEPYDRGATVDIPLDSGNDLRAKE---MELQAKENELKRKEQELKRRE 80
            |.|:...|.|..      ||...|...........|:||.|   |:..::|.|...::|...|:|
Mouse   371 NFTNFAMALNEL------EPGMEGVLAPTDCRLRPDIRAMENGNMDEASREKERLEEKQRAARKE 429

  Fly    81 DAIARTGVVIEEKNW 95
            .|       ..|:.|
Mouse   430 RA-------KNEEEW 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33870NP_001027380.1 HFD_H2B 33..120 CDD:467035 16/66 (24%)
H2bc13NP_835506.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
HFD_H2B 30..123 CDD:467035
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.