DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33870 and H2bc11

DIOPT Version :10

Sequence 1:NP_001027380.1 Gene:His2B:CG33870 / 3772081 FlyBaseID:FBgn0053870 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_835505.1 Gene:H2bc11 / 319183 MGIID:2448388 Length:126 Species:Mus musculus


Alignment Length:46 Identity:12/46 - (26%)
Similarity:18/46 - (39%) Gaps:6/46 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RAKEMELQAKENELKRKEQELKR-----REDAIARTGVVIEEKNWP 96
            |.|.:....|..:..|.:|...|     |...:...||. :|:|.|
Mouse   156 RHKRVHSGEKPYQCDRCQQNFSRTDRLLRHRRLCAVGVP-KEENQP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33870NP_001027380.1 HFD_H2B 33..120 CDD:467035 12/46 (26%)
H2bc11NP_835505.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
HFD_H2B 30..123 CDD:467035
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.