DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33870 and H2bc9

DIOPT Version :10

Sequence 1:NP_001027380.1 Gene:His2B:CG33870 / 3772081 FlyBaseID:FBgn0053870 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_835504.1 Gene:H2bc9 / 319182 MGIID:2448387 Length:126 Species:Mus musculus


Alignment Length:35 Identity:12/35 - (34%)
Similarity:20/35 - (57%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RGATVDIPLDSGNDLRAKEMELQAKENELKRKEQE 75
            ||..|:|..|.|.:.|..:.||:|...|::.:.|:
Mouse  1730 RGRPVEILSDRGTNFRGADAELRAAFEEMETQLQQ 1764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33870NP_001027380.1 HFD_H2B 33..120 CDD:467035 12/35 (34%)
H2bc9NP_835504.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
HFD_H2B 30..123 CDD:467035
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.