DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33837 and h1-10

DIOPT Version :9

Sequence 1:NP_001027339.1 Gene:His1:CG33837 / 3772077 FlyBaseID:FBgn0053837 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001016699.1 Gene:h1-10 / 549453 XenbaseID:XB-GENE-5928644 Length:211 Species:Xenopus tropicalis


Alignment Length:251 Identity:72/251 - (28%)
Similarity:105/251 - (41%) Gaps:58/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPP-----------TQQMVDASIKNLKERGG 65
            |..||.|.:              |.|::..|:||..|           :|..|| :|:.|.||.|
 Frog     5 PETAPEAPL--------------TPAQQVRASPSKSPKKRKKNQPGRYSQLAVD-TIRKLGERNG 54

  Fly    66 SSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAK 130
            |||..|..........|.|....::|..:|:.:.|..|.||:|.||:|||:|:            
 Frog    55 SSLAKIYSEARKVPWFDQQNGRTYLKYSIKALLHNKTLTQTRGVGANGSFRLN------------ 107

  Fly   131 SKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTG 195
               |...|.:|.:|..|         .|.....|.|:|.:. .||..|:..|....||..|:...
 Frog   108 ---LETLKGMQGRKKPS---------VAKRPVSKAPRAPRG-HTKSHAKGHKASPKKAGRARVAA 159

  Fly   196 IIKSKPAATKAKVTAAKPKAVVAKASKAKPAV-SAKPKKTVKKASVSATAKKPKAK 250
              ||...|.:|:|.|..||    ||.:|:.|. |.|..:|.:|.:.|...::|:|:
 Frog   160 --KSPKKAGRARVPAKSPK----KAGRARVAAKSPKKPRTPQKGTRSMKRRQPRAR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33837NP_001027339.1 Linker_histone 46..118 CDD:278939 27/82 (33%)
h1-10NP_001016699.1 Linker_histone 38..107 CDD:366156 26/69 (38%)
valS <116..197 CDD:237855 28/96 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.