DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33837 and H1f4

DIOPT Version :9

Sequence 1:NP_001027339.1 Gene:His1:CG33837 / 3772077 FlyBaseID:FBgn0053837 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_579819.1 Gene:H1f4 / 201097 RGDID:2776 Length:219 Species:Rattus norvegicus


Alignment Length:249 Identity:100/249 - (40%)
Similarity:125/249 - (50%) Gaps:44/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            ||::|.|..|:     ||..||..::|||..:||...:|||.    ||..:::..::...|||.|
  Rat     1 MSETAPAAPAA-----PAPAEKTPIKKKARKAAGGAKRKASG----PPVSELITKAVAASKERSG 56

  Fly    66 SSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||:   ||....:|
  Rat    57 VSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLN---KKAASGEA 116

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKA-------- 186
            |.|              :||.|.:..|...||| ||||.....||.|.:..|..:||        
  Rat   117 KPK--------------AKKAGAAKAKKPAGAA-KKPKKATGTATPKKSTKKTPKKAKKPAAAAG 166

  Fly   187 --KAKDAKKTGIIKSKPA-ATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKK 237
              |||..||....|:|.| .:.||..|.||||...|.||.|   :||||||..|
  Rat   167 AKKAKSPKKAKATKAKKAPKSPAKARAVKPKAAKPKTSKPK---AAKPKKTAAK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33837NP_001027339.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H1f4NP_579819.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 19/48 (40%)
Linker_histone 38..108 CDD:278939 34/71 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..219 61/147 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10170
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4648
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.