DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33837 and si:dkey-108k21.10

DIOPT Version :9

Sequence 1:NP_001027339.1 Gene:His1:CG33837 / 3772077 FlyBaseID:FBgn0053837 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_002666973.1 Gene:si:dkey-108k21.10 / 100333275 ZFINID:ZDB-GENE-131127-26 Length:206 Species:Danio rerio


Alignment Length:241 Identity:94/241 - (39%)
Similarity:123/241 - (51%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |:::|.|  .:|..||          ||.|.|   |.|||.     |..:.::..::...|||.|
Zfish     1 MAETAPA--PAPAKAP----------KKRSAS---KPKKAG-----PNVRDLIVKTVTASKERHG 45

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.::| .|  |.:|....:|..:|:.|:||.|:|.||.||||||||:   ||:.:||.
Zfish    46 VSLAALKKALSAGGY--DVEKNNSRVKTAVKALVLNGTLVQPKGTGASGSFKLN---KKQAEPKK 105

  Fly   130 K---SKVLSAEKKVQSKKVASKKIGVSSKK---TAVGAADKKP-KAKKAVATKKTAENKKTEKAK 187
            |   .|..:..||..:||.|:||.....||   |:|..|.|.| ||||..|.||..::.|  |||
Zfish   106 KPAAKKTAAKAKKPAAKKPAAKKSPKKVKKPAATSVKKATKSPKKAKKPAAAKKATKSPK--KAK 168

  Fly   188 AKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKK 233
            ...|.|      |.|.:..||.|.|||....||:|.|   .|.|||
Zfish   169 KPAAAK------KAAKSPKKVKAVKPKTAKPKAAKPK---KAAPKK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33837NP_001027339.1 Linker_histone 46..118 CDD:278939 30/72 (42%)
si:dkey-108k21.10XP_002666973.1 Linker_histone 27..97 CDD:278939 30/71 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.